gt4sd.algorithms.conditional_generation.regression_transformer.core module¶
RegressionTransformer algorithm.
RegressionTransformer is a mutlitask regression and conditional generation model.
Summary¶
Classes:
RegressionTransformer Algorithm. |
|
Configuration to generate molecules given a continuous property target and a molecular sub-structure. |
|
Configuration to generate protein given a continuous property target and a partial AAs. |
Reference¶
- class RegressionTransformer(configuration, target)[source]¶
Bases:
GeneratorAlgorithm[S,T]RegressionTransformer Algorithm.
- max_samples: int = 50¶
The maximum number of samples a user can try to run in one go
- __init__(configuration, target)[source]¶
Instantiate Regression Transformer ready to generate items.
- Parameters
configuration (
AlgorithmConfiguration[~S, ~T]) – domain and application specification defining parameters, types and validations.target (
Optional[~T,None]) – a target for which to generate items.
Example
An example for generating small molecules (SMILES) with high affinity for a target protein:
config = RegressionTransformerProteins( search='sample', temperature=2.0, tolerance=10 ) target = "<stab>0.393|GSQEVNSGT[MASK][MASK][MASK]YKNASPEEAE[MASK][MASK]IARKAGATTWTEKGNKWEIRI" stability_generator = RegressionTransformer(configuration=config, target=target) items = list(stability_generator.sample(10)) print(items)
- get_generator(configuration, target)[source]¶
Get the function to sample with the given configuration.
- Parameters
configuration (
AlgorithmConfiguration[~S, ~T]) – helps to set up specific application of PaccMannRL.target (
Optional[~T,None]) – context or condition for the generation.
- Return type
Callable[[~T],Iterable[Any]]- Returns
callable with target generating a batch of items.
- validate_configuration(configuration)[source]¶
Overload to validate the a configuration for the algorithm.
- Parameters
configuration (
AlgorithmConfiguration[~S, ~T]) – the algorithm configuration.- Raises
InvalidAlgorithmConfiguration – in case the configuration for the algorithm is invalid.
- Return type
AlgorithmConfiguration[~S, ~T]- Returns
the validated configuration.
- __abstractmethods__ = frozenset({})¶
- __annotations__ = {'generate': 'Untargeted', 'generator': 'Union[Untargeted, Targeted[T]]', 'max_runtime': 'int', 'max_samples': <class 'int'>, 'target': 'Optional[T]'}¶
- __doc__ = 'RegressionTransformer Algorithm.'¶
- __module__ = 'gt4sd.algorithms.conditional_generation.regression_transformer.core'¶
- __orig_bases__ = (gt4sd.algorithms.core.GeneratorAlgorithm[~S, ~T],)¶
- __parameters__ = (~S, ~T)¶
- _abc_impl = <_abc._abc_data object>¶
- class RegressionTransformerMolecules(*args, **kwargs)[source]¶
Bases:
RegressionTransformerMolecules,Generic[T]Configuration to generate molecules given a continuous property target and a molecular sub-structure.
Implementation from the paper: https://arxiv.org/abs/2202.01338.
Examples
An example for generating a peptide around a desired property value:
config = RegressionTransformerMolecules( algorithm_version='solubility', search='sample', temperature=2, tolerance=5 ) target = "<esol>-3.534|[Br][C][=C][C][MASK][MASK][=C][C][=C][C][=C][Ring1][MASK][MASK][Branch2_3][Ring1][Branch1_2]" solubility_generator = RegressionTransformer( configuration=config, target=target ) list(solubility_generator.sample(5))
An example for predicting the solubility of a molecule:
config = RegressionTransformerMolecules( algorithm_version='solubility', search='greedy' ) target = "<esol>[MASK][MASK][MASK][MASK][MASK]|[Cl][C][Branch1_2][Branch1_2][=C][Branch1_1][C][Cl][Cl][Cl]" solubility_generator = RegressionTransformer( configuration=config, target=target ) list(solubility_generator.sample(1))
- algorithm_type: ClassVar[str] = 'conditional_generation'¶
General type of generative algorithm.
- domain: ClassVar[str] = 'materials'¶
General application domain. Hints at input/output types.
- algorithm_version: str = 'solubility'¶
To differentiate between different versions of an application.
There is no imposed naming convention.
- search: str = 'sample'¶
- temperature: float = 1.4¶
- batch_size: int = 8¶
- tolerance: Union[float, Dict[str, float]] = 20.0¶
- sampling_wrapper: Dict¶
- get_target_description()[source]¶
Get description of the target for generation.
- Return type
Dict[str,str]- Returns
target description.
- get_conditional_generator(resources_path, context)[source]¶
Instantiate the actual generator implementation.
- Parameters
resources_path (
str) – local path to model files.- Return type
- Returns
instance with
generate_batchmethod for targeted generation.
- validate_item(item)[source]¶
Check that item is a valid sequence.
- Parameters
item (
str) – a generated item that is possibly not valid.- Raises
InvalidItem – in case the item can not be validated.
- Return type
Union[str,Mol]- Returns
the validated item.
- classmethod get_filepath_mappings_for_training_pipeline_arguments()[source]¶
Get filepath mappings for the given training pipeline arguments. :type training_pipeline_arguments:
TrainingPipelineArguments:param training_pipeline_arguments: training pipeline arguments.- Return type
Dict[str,str]- Returns
a mapping between artifacts’ files and training pipeline’s output files.
- __annotations__ = {'algorithm_application': 'ClassVar[str]', 'algorithm_name': 'ClassVar[str]', 'algorithm_type': typing.ClassVar[str], 'algorithm_version': <class 'str'>, 'batch_size': <class 'int'>, 'domain': typing.ClassVar[str], 'sampling_wrapper': typing.Dict, 'search': <class 'str'>, 'temperature': <class 'float'>, 'tolerance': typing.Union[float, typing.Dict[str, float]]}¶
- __dataclass_fields__ = {'algorithm_application': Field(name='algorithm_application',type=typing.ClassVar[str],default='RegressionTransformerMolecules',default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({}),kw_only=<dataclasses._MISSING_TYPE object>,_field_type=_FIELD_CLASSVAR), 'algorithm_name': Field(name='algorithm_name',type=typing.ClassVar[str],default='RegressionTransformer',default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({}),kw_only=<dataclasses._MISSING_TYPE object>,_field_type=_FIELD_CLASSVAR), 'algorithm_type': Field(name='algorithm_type',type=typing.ClassVar[str],default='conditional_generation',default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({}),kw_only=<dataclasses._MISSING_TYPE object>,_field_type=_FIELD_CLASSVAR), 'algorithm_version': Field(name='algorithm_version',type=<class 'str'>,default='solubility',default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({'description': 'The version of the algorithm to use.', 'options': ['solubility', 'qed', 'logp_and_synthesizability']}),kw_only=False,_field_type=_FIELD), 'batch_size': Field(name='batch_size',type=<class 'int'>,default=8,default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({'description': 'Batch size for the conditional generation'}),kw_only=False,_field_type=_FIELD), 'domain': Field(name='domain',type=typing.ClassVar[str],default='materials',default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({}),kw_only=<dataclasses._MISSING_TYPE object>,_field_type=_FIELD_CLASSVAR), 'sampling_wrapper': Field(name='sampling_wrapper',type=typing.Dict,default=<dataclasses._MISSING_TYPE object>,default_factory=<class 'dict'>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({'description': "High-level entry point for SMILES-level access. Provide a\n dictionary that is used to build a custom sampling wrapper.\n NOTE: If this is used, the `target` needs to be a single SMILES string.\n Example: {\n 'fraction_to_mask': 0.5,\n 'tokens_to_mask': [],\n 'property_goal': {'<qed>': 0.85}\n }\n - 'fraction_to_mask' specifies the ratio of tokens that can be changed by\n the model.\n - 'tokens_to_mask' specifies which atoms can be masked. This defaults\n to an empty list, meaning that all tokens can be masked.\n - 'property_goal' specifies the target conditions for the generation. The\n properties need to be specified as a dictionary. The keys need to be\n properties supported by the algorithm version.\n - 'substructures_to_mask': Specifies a list of substructures that should be masked.\n Given in SMILES format. This is excluded from the stochastic masking.\n NOTE: The model operates on SELFIES and the matching of the substructures occurs\n in SELFIES simply on a string level.\n - 'substructures_to_keep': Specifies a list of substructures that should definitely be kept.\n Given in SMILES format. This is excluded from the stochastic masking.\n NOTE: This keeps tokens even if they are included in `tokens_to_mask`.\n NOTE: The model operates on SELFIES and the matching of the substructures occurs\n in SELFIES simply on a string level.\n - `text_filtering`: Generated sequences are post-hoc filtered for the presence of\n `substructures_to_keep`. This is done with RDKit substructure matches. If the sub-\n structure cant be converted to a mol object, this argument toggles whether a substructure\n should be ignored from post-hoc filtering (this happens per default) or whether\n filtering should occur on a pure string level. Defaults to False.\n NOTE: This does not affect the actual generation process.\n "}),kw_only=False,_field_type=_FIELD), 'search': Field(name='search',type=<class 'str'>,default='sample',default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({'description': 'Search algorithm to use for the generation: sample or greedy', 'options': ['sample', 'greedy']}),kw_only=False,_field_type=_FIELD), 'temperature': Field(name='temperature',type=<class 'float'>,default=1.4,default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({'description': 'Temperature parameter for the softmax sampling in decoding.'}),kw_only=False,_field_type=_FIELD), 'tolerance': Field(name='tolerance',type=typing.Union[float, typing.Dict[str, float]],default=20.0,default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({'description': 'Precision tolerance for the conditional generation task. This is the\n tolerated eviation between desired/primed property and predicted property of the\n generated molecule. Given in percentage with respect to the property range encountered\n during training. Either a single float or a dict of floats with properties as\n NOTE: The tolerance is *only* used for post-hoc filtering of the generated molecules.\n '}),kw_only=False,_field_type=_FIELD)}¶
- __dataclass_params__ = _DataclassParams(init=True,repr=True,eq=True,order=False,unsafe_hash=False,frozen=False)¶
- __doc__ = '\n Configuration to generate molecules given a continuous property target and a molecular sub-structure.\n\n Implementation from the paper: https://arxiv.org/abs/2202.01338.\n\n Examples:\n An example for generating a peptide around a desired property value::\n\n config = RegressionTransformerMolecules(\n algorithm_version=\'solubility\', search=\'sample\', temperature=2, tolerance=5\n )\n target = "<esol>-3.534|[Br][C][=C][C][MASK][MASK][=C][C][=C][C][=C][Ring1][MASK][MASK][Branch2_3][Ring1][Branch1_2]"\n solubility_generator = RegressionTransformer(\n configuration=config, target=target\n )\n list(solubility_generator.sample(5))\n\n An example for predicting the solubility of a molecule::\n\n config = RegressionTransformerMolecules(\n algorithm_version=\'solubility\', search=\'greedy\'\n )\n target = "<esol>[MASK][MASK][MASK][MASK][MASK]|[Cl][C][Branch1_2][Branch1_2][=C][Branch1_1][C][Cl][Cl][Cl]"\n solubility_generator = RegressionTransformer(\n configuration=config, target=target\n )\n list(solubility_generator.sample(1))\n '¶
- __eq__(other)¶
Return self==value.
- __hash__ = None¶
- __init__(*args, **kwargs)¶
- __is_pydantic_dataclass__ = True¶
- __match_args__ = ('algorithm_version', 'search', 'temperature', 'batch_size', 'tolerance', 'sampling_wrapper')¶
- __module__ = 'gt4sd.algorithms.conditional_generation.regression_transformer.core'¶
- __orig_bases__ = (<class 'types.RegressionTransformerMolecules'>, typing.Generic[~T])¶
- __parameters__ = (~T,)¶
- __pydantic_complete__ = True¶
- __pydantic_config__ = {}¶
- __pydantic_core_schema__ = {'cls': <class 'gt4sd.algorithms.conditional_generation.regression_transformer.core.RegressionTransformerMolecules'>, 'config': {'title': 'RegressionTransformerMolecules'}, 'fields': ['algorithm_version', 'search', 'temperature', 'batch_size', 'tolerance', 'sampling_wrapper'], 'frozen': False, 'post_init': False, 'ref': 'types.RegressionTransformerMolecules:94159575086272', 'schema': {'collect_init_only': False, 'computed_fields': [], 'dataclass_name': 'RegressionTransformerMolecules', 'fields': [{'type': 'dataclass-field', 'name': 'algorithm_version', 'schema': {'type': 'default', 'schema': {'type': 'str'}, 'default': 'solubility'}, 'kw_only': False, 'init': True, 'metadata': {'pydantic_js_updates': {'description': 'The version of the algorithm to use.'}}}, {'type': 'dataclass-field', 'name': 'search', 'schema': {'type': 'default', 'schema': {'type': 'str'}, 'default': 'sample'}, 'kw_only': False, 'init': True, 'metadata': {'pydantic_js_updates': {'description': 'Search algorithm to use for the generation: sample or greedy'}}}, {'type': 'dataclass-field', 'name': 'temperature', 'schema': {'type': 'default', 'schema': {'type': 'float'}, 'default': 1.4}, 'kw_only': False, 'init': True, 'metadata': {'pydantic_js_updates': {'description': 'Temperature parameter for the softmax sampling in decoding.'}}}, {'type': 'dataclass-field', 'name': 'batch_size', 'schema': {'type': 'default', 'schema': {'type': 'int'}, 'default': 8}, 'kw_only': False, 'init': True, 'metadata': {'pydantic_js_updates': {'description': 'Batch size for the conditional generation'}}}, {'type': 'dataclass-field', 'name': 'tolerance', 'schema': {'type': 'default', 'schema': {'type': 'union', 'choices': [{'type': 'float'}, {'type': 'dict', 'keys_schema': {'type': 'str'}, 'values_schema': {'type': 'float'}}]}, 'default': 20.0}, 'kw_only': False, 'init': True, 'metadata': {'pydantic_js_updates': {'description': 'Precision tolerance for the conditional generation task. This is the\n tolerated eviation between desired/primed property and predicted property of the\n generated molecule. Given in percentage with respect to the property range encountered\n during training. Either a single float or a dict of floats with properties as\n NOTE: The tolerance is *only* used for post-hoc filtering of the generated molecules.\n '}}}, {'type': 'dataclass-field', 'name': 'sampling_wrapper', 'schema': {'type': 'default', 'schema': {'type': 'dict', 'keys_schema': {'type': 'any'}, 'values_schema': {'type': 'any'}}, 'default_factory': <class 'dict'>, 'default_factory_takes_data': False}, 'kw_only': False, 'init': True, 'metadata': {'pydantic_js_updates': {'description': "High-level entry point for SMILES-level access. Provide a\n dictionary that is used to build a custom sampling wrapper.\n NOTE: If this is used, the `target` needs to be a single SMILES string.\n Example: {\n 'fraction_to_mask': 0.5,\n 'tokens_to_mask': [],\n 'property_goal': {'<qed>': 0.85}\n }\n - 'fraction_to_mask' specifies the ratio of tokens that can be changed by\n the model.\n - 'tokens_to_mask' specifies which atoms can be masked. This defaults\n to an empty list, meaning that all tokens can be masked.\n - 'property_goal' specifies the target conditions for the generation. The\n properties need to be specified as a dictionary. The keys need to be\n properties supported by the algorithm version.\n - 'substructures_to_mask': Specifies a list of substructures that should be masked.\n Given in SMILES format. This is excluded from the stochastic masking.\n NOTE: The model operates on SELFIES and the matching of the substructures occurs\n in SELFIES simply on a string level.\n - 'substructures_to_keep': Specifies a list of substructures that should definitely be kept.\n Given in SMILES format. This is excluded from the stochastic masking.\n NOTE: This keeps tokens even if they are included in `tokens_to_mask`.\n NOTE: The model operates on SELFIES and the matching of the substructures occurs\n in SELFIES simply on a string level.\n - `text_filtering`: Generated sequences are post-hoc filtered for the presence of\n `substructures_to_keep`. This is done with RDKit substructure matches. If the sub-\n structure cant be converted to a mol object, this argument toggles whether a substructure\n should be ignored from post-hoc filtering (this happens per default) or whether\n filtering should occur on a pure string level. Defaults to False.\n NOTE: This does not affect the actual generation process.\n "}}}], 'type': 'dataclass-args'}, 'slots': True, 'type': 'dataclass'}¶
- __pydantic_decorators__ = DecoratorInfos(validators={}, field_validators={}, root_validators={}, field_serializers={}, model_serializers={}, model_validators={}, computed_fields={})¶
- __pydantic_fields__ = {'algorithm_version': FieldInfo(annotation=str, required=False, default='solubility', description='The version of the algorithm to use.', init=True, kw_only=False), 'batch_size': FieldInfo(annotation=int, required=False, default=8, description='Batch size for the conditional generation', init=True, kw_only=False), 'sampling_wrapper': FieldInfo(annotation=Dict, required=False, default_factory=dict, description="High-level entry point for SMILES-level access. Provide a\n dictionary that is used to build a custom sampling wrapper.\n NOTE: If this is used, the `target` needs to be a single SMILES string.\n Example: {\n 'fraction_to_mask': 0.5,\n 'tokens_to_mask': [],\n 'property_goal': {'<qed>': 0.85}\n }\n - 'fraction_to_mask' specifies the ratio of tokens that can be changed by\n the model.\n - 'tokens_to_mask' specifies which atoms can be masked. This defaults\n to an empty list, meaning that all tokens can be masked.\n - 'property_goal' specifies the target conditions for the generation. The\n properties need to be specified as a dictionary. The keys need to be\n properties supported by the algorithm version.\n - 'substructures_to_mask': Specifies a list of substructures that should be masked.\n Given in SMILES format. This is excluded from the stochastic masking.\n NOTE: The model operates on SELFIES and the matching of the substructures occurs\n in SELFIES simply on a string level.\n - 'substructures_to_keep': Specifies a list of substructures that should definitely be kept.\n Given in SMILES format. This is excluded from the stochastic masking.\n NOTE: This keeps tokens even if they are included in `tokens_to_mask`.\n NOTE: The model operates on SELFIES and the matching of the substructures occurs\n in SELFIES simply on a string level.\n - `text_filtering`: Generated sequences are post-hoc filtered for the presence of\n `substructures_to_keep`. This is done with RDKit substructure matches. If the sub-\n structure cant be converted to a mol object, this argument toggles whether a substructure\n should be ignored from post-hoc filtering (this happens per default) or whether\n filtering should occur on a pure string level. Defaults to False.\n NOTE: This does not affect the actual generation process.\n ", init=True, kw_only=False), 'search': FieldInfo(annotation=str, required=False, default='sample', description='Search algorithm to use for the generation: sample or greedy', init=True, kw_only=False), 'temperature': FieldInfo(annotation=float, required=False, default=1.4, description='Temperature parameter for the softmax sampling in decoding.', init=True, kw_only=False), 'tolerance': FieldInfo(annotation=Union[float, Dict[str, float]], required=False, default=20.0, description='Precision tolerance for the conditional generation task. This is the\n tolerated eviation between desired/primed property and predicted property of the\n generated molecule. Given in percentage with respect to the property range encountered\n during training. Either a single float or a dict of floats with properties as\n NOTE: The tolerance is *only* used for post-hoc filtering of the generated molecules.\n ', init=True, kw_only=False)}¶
- classmethod __pydantic_fields_complete__()¶
Return whether the fields were successfully collected (i.e. type hints were successfully resolved).
This is a private helper, not meant to be used outside Pydantic.
- Return type
bool
- __pydantic_serializer__ = SchemaSerializer(serializer=PolymorphismTrampoline( PolymorphismTrampoline { class: Py( 0x000055a33c0674c0, ), serializer: PolymorphismTrampoline( PolymorphismTrampoline { class: Py( 0x000055a33c0674c0, ), serializer: Dataclass( DataclassSerializer { class: Py( 0x000055a33c0674c0, ), serializer: Fields( GeneralFieldsSerializer { fields: { "tolerance": SerField { key: "tolerance", alias: None, serializer: Some( WithDefault( WithDefaultSerializer { default: Default( Py( 0x00007fbde4f1b530, ), ), serializer: Union( UnionSerializer { choices: UnionChoices { choices: [ Float( FloatSerializer { inf_nan_mode: Null, }, ), Dict( DictSerializer { key_serializer: Str( StrSerializer, ), value_serializer: Float( FloatSerializer { inf_nan_mode: Null, }, ), filter: SchemaFilter { include: None, exclude: None, }, name: "dict[str, float]", }, ), ], }, name: "Union[float, dict[str, float]]", }, ), }, ), ), required: true, serialize_by_alias: None, serialization_exclude_if: None, }, "sampling_wrapper": SerField { key: "sampling_wrapper", alias: None, serializer: Some( WithDefault( WithDefaultSerializer { default: DefaultFactory( Py( 0x000055a327ccfec0, ), false, ), serializer: Dict( DictSerializer { key_serializer: Any( AnySerializer, ), value_serializer: Any( AnySerializer, ), filter: SchemaFilter { include: None, exclude: None, }, name: "dict[any, any]", }, ), }, ), ), required: true, serialize_by_alias: None, serialization_exclude_if: None, }, "temperature": SerField { key: "temperature", alias: None, serializer: Some( WithDefault( WithDefaultSerializer { default: Default( Py( 0x00007fbde4f1ab30, ), ), serializer: Float( FloatSerializer { inf_nan_mode: Null, }, ), }, ), ), required: true, serialize_by_alias: None, serialization_exclude_if: None, }, "batch_size": SerField { key: "batch_size", alias: None, serializer: Some( WithDefault( WithDefaultSerializer { default: Default( Py( 0x00007fbecab001d0, ), ), serializer: Int( IntSerializer, ), }, ), ), required: true, serialize_by_alias: None, serialization_exclude_if: None, }, "algorithm_version": SerField { key: "algorithm_version", alias: None, serializer: Some( WithDefault( WithDefaultSerializer { default: Default( Py( 0x00007fbde982fa70, ), ), serializer: Str( StrSerializer, ), }, ), ), required: true, serialize_by_alias: None, serialization_exclude_if: None, }, "search": SerField { key: "search", alias: None, serializer: Some( WithDefault( WithDefaultSerializer { default: Default( Py( 0x00007fbec9fd4f70, ), ), serializer: Str( StrSerializer, ), }, ), ), required: true, serialize_by_alias: None, serialization_exclude_if: None, }, }, computed_fields: Some( ComputedFields( [], ), ), mode: SimpleDict, extra_serializer: None, filter: SchemaFilter { include: None, exclude: None, }, required_fields: 6, }, ), fields: [ Py( 0x00007fbec643dde0, ), Py( 0x00007fbecab9ecb0, ), Py( 0x00007fbe51111c30, ), Py( 0x00007fbec64387b0, ), Py( 0x00007fbec6410cf0, ), Py( 0x00007fbde4b4ef60, ), ], name: "RegressionTransformerMolecules", }, ), enabled_from_config: false, }, ), enabled_from_config: false, }, ), definitions=[])¶
- __pydantic_validator__ = SchemaValidator(title="RegressionTransformerMolecules", validator=Dataclass( DataclassValidator { strict: false, validator: DataclassArgs( DataclassArgsValidator { fields: [ Field { kw_only: false, name: "algorithm_version", init: true, init_only: false, lookup_path_collection: LookupPathCollection { by_name: LookupPath { first_item: PathItemString( "algorithm_version", ), rest: [], }, by_alias: [], }, validator: WithDefault( WithDefaultValidator { default: Default( Py( 0x00007fbde982fa70, ), ), on_error: Raise, validator: Str( StrValidator { strict: false, coerce_numbers_to_str: false, }, ), validate_default: false, copy_default: false, name: "default[str]", undefined: Py( 0x00007fbec86c3ba0, ), }, ), frozen: false, }, Field { kw_only: false, name: "search", init: true, init_only: false, lookup_path_collection: LookupPathCollection { by_name: LookupPath { first_item: PathItemString( "search", ), rest: [], }, by_alias: [], }, validator: WithDefault( WithDefaultValidator { default: Default( Py( 0x00007fbec9fd4f70, ), ), on_error: Raise, validator: Str( StrValidator { strict: false, coerce_numbers_to_str: false, }, ), validate_default: false, copy_default: false, name: "default[str]", undefined: Py( 0x00007fbec86c3ba0, ), }, ), frozen: false, }, Field { kw_only: false, name: "temperature", init: true, init_only: false, lookup_path_collection: LookupPathCollection { by_name: LookupPath { first_item: PathItemString( "temperature", ), rest: [], }, by_alias: [], }, validator: WithDefault( WithDefaultValidator { default: Default( Py( 0x00007fbde4f1ab30, ), ), on_error: Raise, validator: Float( FloatValidator { strict: false, allow_inf_nan: true, }, ), validate_default: false, copy_default: false, name: "default[float]", undefined: Py( 0x00007fbec86c3ba0, ), }, ), frozen: false, }, Field { kw_only: false, name: "batch_size", init: true, init_only: false, lookup_path_collection: LookupPathCollection { by_name: LookupPath { first_item: PathItemString( "batch_size", ), rest: [], }, by_alias: [], }, validator: WithDefault( WithDefaultValidator { default: Default( Py( 0x00007fbecab001d0, ), ), on_error: Raise, validator: Int( IntValidator { strict: false, }, ), validate_default: false, copy_default: false, name: "default[int]", undefined: Py( 0x00007fbec86c3ba0, ), }, ), frozen: false, }, Field { kw_only: false, name: "tolerance", init: true, init_only: false, lookup_path_collection: LookupPathCollection { by_name: LookupPath { first_item: PathItemString( "tolerance", ), rest: [], }, by_alias: [], }, validator: WithDefault( WithDefaultValidator { default: Default( Py( 0x00007fbde4f1b530, ), ), on_error: Raise, validator: Union( UnionValidator { mode: Smart, choices: [ ( Float( FloatValidator { strict: false, allow_inf_nan: true, }, ), None, ), ( Dict( DictValidator { strict: false, key_validator: Str( StrValidator { strict: false, coerce_numbers_to_str: false, }, ), value_validator: Float( FloatValidator { strict: false, allow_inf_nan: true, }, ), min_length: None, max_length: None, fail_fast: false, name: "dict[str,float]", }, ), None, ), ], custom_error: None, name: "union[float,dict[str,float]]", }, ), validate_default: false, copy_default: false, name: "default[union[float,dict[str,float]]]", undefined: Py( 0x00007fbec86c3ba0, ), }, ), frozen: false, }, Field { kw_only: false, name: "sampling_wrapper", init: true, init_only: false, lookup_path_collection: LookupPathCollection { by_name: LookupPath { first_item: PathItemString( "sampling_wrapper", ), rest: [], }, by_alias: [], }, validator: WithDefault( WithDefaultValidator { default: DefaultFactory( Py( 0x000055a327ccfec0, ), false, ), on_error: Raise, validator: Dict( DictValidator { strict: false, key_validator: Any( AnyValidator, ), value_validator: Any( AnyValidator, ), min_length: None, max_length: None, fail_fast: false, name: "dict[any,any]", }, ), validate_default: false, copy_default: false, name: "default[dict[any,any]]", undefined: Py( 0x00007fbec86c3ba0, ), }, ), frozen: false, }, ], positional_count: 6, init_only_count: None, dataclass_name: "RegressionTransformerMolecules", validator_name: "dataclass-args[RegressionTransformerMolecules]", extra_behavior: Ignore, extras_validator: None, loc_by_alias: true, validate_by_alias: None, validate_by_name: None, }, ), class: Py( 0x000055a33c0674c0, ), generic_origin: None, fields: [ Py( 0x00007fbec643dde0, ), Py( 0x00007fbecab9ecb0, ), Py( 0x00007fbe51111c30, ), Py( 0x00007fbec64387b0, ), Py( 0x00007fbec6410cf0, ), Py( 0x00007fbde4b4ef60, ), ], post_init: None, revalidate: Never, name: "RegressionTransformerMolecules", frozen: false, slots: true, }, ), definitions=[], cache_strings=True)¶
- __repr__()¶
Return repr(self).
- __signature__ = <Signature (algorithm_version: str = 'solubility', search: str = 'sample', temperature: float = 1.4, batch_size: int = 8, tolerance: Union[float, Dict[str, float]] = 20.0, sampling_wrapper: Dict = <factory>) -> None>¶
- __wrapped__¶
alias of
RegressionTransformerMolecules
- class RegressionTransformerProteins(*args, **kwargs)[source]¶
Bases:
RegressionTransformerProteins,Generic[T]Configuration to generate protein given a continuous property target and a partial AAs.
Implementation from the paper: https://arxiv.org/abs/2202.01338. It can also predict the property given a full sequence.
Examples
An example for generating a peptide around a desired property value:
config = RegressionTransformerProteins( search='sample', temperature=2, tolerance=5 ) target = "<stab>1.1234|TTIKNG[MASK][MASK][MASK]YTVPLSPEQAAK[MASK][MASK][MASK]KKRWPDYEVQIHGNTVKVT" stability_generator = RegressionTransformer( configuration=config, target=target ) list(stability_generator.sample(5))
An example for predicting the stability of a peptide:
config = RegressionTransformerProteins(search='greedy') target = "<stab>[MASK][MASK][MASK][MASK][MASK]|GSQEVNSNASPEEAEIARKAGATTWTEKGNKWEIRI" stability_generator = RegressionTransformer( configuration=config, target=target ) list(stability_generator.sample(1))
- algorithm_type: ClassVar[str] = 'conditional_generation'¶
General type of generative algorithm.
- domain: ClassVar[str] = 'materials'¶
General application domain. Hints at input/output types.
- algorithm_version: str = 'stability'¶
To differentiate between different versions of an application.
There is no imposed naming convention.
- search: str = 'sample'¶
- temperature: float = 1.4¶
- batch_size: int = 32¶
- tolerance: Union[float, Dict[str, float]] = 20.0¶
- sampling_wrapper: Dict¶
- get_target_description()[source]¶
Get description of the target for generation.
- Return type
Dict[str,str]- Returns
target description.
- get_conditional_generator(resources_path, context)[source]¶
Instantiate the actual generator implementation.
- Parameters
resources_path (
str) – local path to model files.context (
str) – input sequence to be used for the generation.
- Return type
- Returns
instance with
generate_batchmethod for targeted generation.
- validate_item(item)[source]¶
Check that item is a valid sequence.
- Parameters
item (
str) – a generated item that is possibly not valid.- Raises
InvalidItem – in case the item can not be validated.
- Return type
Union[str,Mol]- Returns
the validated item.
- __annotations__ = {'algorithm_application': 'ClassVar[str]', 'algorithm_name': 'ClassVar[str]', 'algorithm_type': typing.ClassVar[str], 'algorithm_version': <class 'str'>, 'batch_size': <class 'int'>, 'domain': typing.ClassVar[str], 'sampling_wrapper': typing.Dict, 'search': <class 'str'>, 'temperature': <class 'float'>, 'tolerance': typing.Union[float, typing.Dict[str, float]]}¶
- __dataclass_fields__ = {'algorithm_application': Field(name='algorithm_application',type=typing.ClassVar[str],default='RegressionTransformerProteins',default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({}),kw_only=<dataclasses._MISSING_TYPE object>,_field_type=_FIELD_CLASSVAR), 'algorithm_name': Field(name='algorithm_name',type=typing.ClassVar[str],default='RegressionTransformer',default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({}),kw_only=<dataclasses._MISSING_TYPE object>,_field_type=_FIELD_CLASSVAR), 'algorithm_type': Field(name='algorithm_type',type=typing.ClassVar[str],default='conditional_generation',default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({}),kw_only=<dataclasses._MISSING_TYPE object>,_field_type=_FIELD_CLASSVAR), 'algorithm_version': Field(name='algorithm_version',type=<class 'str'>,default='stability',default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({'description': 'The version of the algorithm to use.', 'options': ['stability']}),kw_only=False,_field_type=_FIELD), 'batch_size': Field(name='batch_size',type=<class 'int'>,default=32,default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({'description': 'Batch size for the conditional generation'}),kw_only=False,_field_type=_FIELD), 'domain': Field(name='domain',type=typing.ClassVar[str],default='materials',default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({}),kw_only=<dataclasses._MISSING_TYPE object>,_field_type=_FIELD_CLASSVAR), 'sampling_wrapper': Field(name='sampling_wrapper',type=typing.Dict,default=<dataclasses._MISSING_TYPE object>,default_factory=<class 'dict'>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({'description': "High-level entry point for SMILES-level access. Provide a\n dictionary that is used to build a custom sampling wrapper.\n NOTE: If this is used, the `target` needs to be a single SMILES string.\n Example: {\n 'fraction_to_mask': 0.5,\n 'tokens_to_mask': [],\n 'property_goal': {'<qed>': 0.85}\n }\n - 'fraction_to_mask' specifies the ratio of tokens that can be changed by\n the model.\n - 'tokens_to_mask' specifies which atoms can be masked. This defaults\n to an empty list, meaning that all tokens can be masked.\n - 'property_goal' specifies the target conditions for the generation. The\n properties need to be specified as a dictionary. The keys need to be\n properties supported by the algorithm version.\n "}),kw_only=False,_field_type=_FIELD), 'search': Field(name='search',type=<class 'str'>,default='sample',default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({'description': 'Search algorithm to use for the generation: sample or greedy'}),kw_only=False,_field_type=_FIELD), 'temperature': Field(name='temperature',type=<class 'float'>,default=1.4,default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({'description': 'Temperature parameter for the softmax sampling in decoding.'}),kw_only=False,_field_type=_FIELD), 'tolerance': Field(name='tolerance',type=typing.Union[float, typing.Dict[str, float]],default=20.0,default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({'description': 'Precision tolerance for the conditional generation task. This is the\n tolerated eviation between desired/primed property and predicted property of the\n generated molecule. Given in percentage with respect to the property range encountered\n during training. Either a single float or a dict of floats with properties as\n NOTE: The tolerance is *only* used for post-hoc filtering of the generated proteins.\n '}),kw_only=False,_field_type=_FIELD)}¶
- __dataclass_params__ = _DataclassParams(init=True,repr=True,eq=True,order=False,unsafe_hash=False,frozen=False)¶
- __doc__ = '\n Configuration to generate protein given a continuous property target and a partial AAs.\n\n Implementation from the paper: https://arxiv.org/abs/2202.01338. It can also predict the property given a full sequence.\n\n Examples:\n An example for generating a peptide around a desired property value::\n\n config = RegressionTransformerProteins(\n search=\'sample\', temperature=2, tolerance=5\n )\n target = "<stab>1.1234|TTIKNG[MASK][MASK][MASK]YTVPLSPEQAAK[MASK][MASK][MASK]KKRWPDYEVQIHGNTVKVT"\n stability_generator = RegressionTransformer(\n configuration=config, target=target\n )\n list(stability_generator.sample(5))\n\n An example for predicting the stability of a peptide::\n\n config = RegressionTransformerProteins(search=\'greedy\')\n target = "<stab>[MASK][MASK][MASK][MASK][MASK]|GSQEVNSNASPEEAEIARKAGATTWTEKGNKWEIRI"\n stability_generator = RegressionTransformer(\n configuration=config, target=target\n )\n list(stability_generator.sample(1))\n '¶
- __eq__(other)¶
Return self==value.
- __hash__ = None¶
- __init__(*args, **kwargs)¶
- __is_pydantic_dataclass__ = True¶
- __match_args__ = ('algorithm_version', 'search', 'temperature', 'batch_size', 'tolerance', 'sampling_wrapper')¶
- __module__ = 'gt4sd.algorithms.conditional_generation.regression_transformer.core'¶
- __orig_bases__ = (<class 'types.RegressionTransformerProteins'>, typing.Generic[~T])¶
- __parameters__ = (~T,)¶
- __pydantic_complete__ = True¶
- __pydantic_config__ = {}¶
- __pydantic_core_schema__ = {'cls': <class 'gt4sd.algorithms.conditional_generation.regression_transformer.core.RegressionTransformerProteins'>, 'config': {'title': 'RegressionTransformerProteins'}, 'fields': ['algorithm_version', 'search', 'temperature', 'batch_size', 'tolerance', 'sampling_wrapper'], 'frozen': False, 'post_init': False, 'ref': 'types.RegressionTransformerProteins:94159574922048', 'schema': {'collect_init_only': False, 'computed_fields': [], 'dataclass_name': 'RegressionTransformerProteins', 'fields': [{'type': 'dataclass-field', 'name': 'algorithm_version', 'schema': {'type': 'default', 'schema': {'type': 'str'}, 'default': 'stability'}, 'kw_only': False, 'init': True, 'metadata': {'pydantic_js_updates': {'description': 'The version of the algorithm to use.'}}}, {'type': 'dataclass-field', 'name': 'search', 'schema': {'type': 'default', 'schema': {'type': 'str'}, 'default': 'sample'}, 'kw_only': False, 'init': True, 'metadata': {'pydantic_js_updates': {'description': 'Search algorithm to use for the generation: sample or greedy'}}}, {'type': 'dataclass-field', 'name': 'temperature', 'schema': {'type': 'default', 'schema': {'type': 'float'}, 'default': 1.4}, 'kw_only': False, 'init': True, 'metadata': {'pydantic_js_updates': {'description': 'Temperature parameter for the softmax sampling in decoding.'}}}, {'type': 'dataclass-field', 'name': 'batch_size', 'schema': {'type': 'default', 'schema': {'type': 'int'}, 'default': 32}, 'kw_only': False, 'init': True, 'metadata': {'pydantic_js_updates': {'description': 'Batch size for the conditional generation'}}}, {'type': 'dataclass-field', 'name': 'tolerance', 'schema': {'type': 'default', 'schema': {'type': 'union', 'choices': [{'type': 'float'}, {'type': 'dict', 'keys_schema': {'type': 'str'}, 'values_schema': {'type': 'float'}}]}, 'default': 20.0}, 'kw_only': False, 'init': True, 'metadata': {'pydantic_js_updates': {'description': 'Precision tolerance for the conditional generation task. This is the\n tolerated eviation between desired/primed property and predicted property of the\n generated molecule. Given in percentage with respect to the property range encountered\n during training. Either a single float or a dict of floats with properties as\n NOTE: The tolerance is *only* used for post-hoc filtering of the generated proteins.\n '}}}, {'type': 'dataclass-field', 'name': 'sampling_wrapper', 'schema': {'type': 'default', 'schema': {'type': 'dict', 'keys_schema': {'type': 'any'}, 'values_schema': {'type': 'any'}}, 'default_factory': <class 'dict'>, 'default_factory_takes_data': False}, 'kw_only': False, 'init': True, 'metadata': {'pydantic_js_updates': {'description': "High-level entry point for SMILES-level access. Provide a\n dictionary that is used to build a custom sampling wrapper.\n NOTE: If this is used, the `target` needs to be a single SMILES string.\n Example: {\n 'fraction_to_mask': 0.5,\n 'tokens_to_mask': [],\n 'property_goal': {'<qed>': 0.85}\n }\n - 'fraction_to_mask' specifies the ratio of tokens that can be changed by\n the model.\n - 'tokens_to_mask' specifies which atoms can be masked. This defaults\n to an empty list, meaning that all tokens can be masked.\n - 'property_goal' specifies the target conditions for the generation. The\n properties need to be specified as a dictionary. The keys need to be\n properties supported by the algorithm version.\n "}}}], 'type': 'dataclass-args'}, 'slots': True, 'type': 'dataclass'}¶
- __pydantic_decorators__ = DecoratorInfos(validators={}, field_validators={}, root_validators={}, field_serializers={}, model_serializers={}, model_validators={}, computed_fields={})¶
- __pydantic_fields__ = {'algorithm_version': FieldInfo(annotation=str, required=False, default='stability', description='The version of the algorithm to use.', init=True, kw_only=False), 'batch_size': FieldInfo(annotation=int, required=False, default=32, description='Batch size for the conditional generation', init=True, kw_only=False), 'sampling_wrapper': FieldInfo(annotation=Dict, required=False, default_factory=dict, description="High-level entry point for SMILES-level access. Provide a\n dictionary that is used to build a custom sampling wrapper.\n NOTE: If this is used, the `target` needs to be a single SMILES string.\n Example: {\n 'fraction_to_mask': 0.5,\n 'tokens_to_mask': [],\n 'property_goal': {'<qed>': 0.85}\n }\n - 'fraction_to_mask' specifies the ratio of tokens that can be changed by\n the model.\n - 'tokens_to_mask' specifies which atoms can be masked. This defaults\n to an empty list, meaning that all tokens can be masked.\n - 'property_goal' specifies the target conditions for the generation. The\n properties need to be specified as a dictionary. The keys need to be\n properties supported by the algorithm version.\n ", init=True, kw_only=False), 'search': FieldInfo(annotation=str, required=False, default='sample', description='Search algorithm to use for the generation: sample or greedy', init=True, kw_only=False), 'temperature': FieldInfo(annotation=float, required=False, default=1.4, description='Temperature parameter for the softmax sampling in decoding.', init=True, kw_only=False), 'tolerance': FieldInfo(annotation=Union[float, Dict[str, float]], required=False, default=20.0, description='Precision tolerance for the conditional generation task. This is the\n tolerated eviation between desired/primed property and predicted property of the\n generated molecule. Given in percentage with respect to the property range encountered\n during training. Either a single float or a dict of floats with properties as\n NOTE: The tolerance is *only* used for post-hoc filtering of the generated proteins.\n ', init=True, kw_only=False)}¶
- classmethod __pydantic_fields_complete__()¶
Return whether the fields were successfully collected (i.e. type hints were successfully resolved).
This is a private helper, not meant to be used outside Pydantic.
- Return type
bool
- __pydantic_serializer__ = SchemaSerializer(serializer=PolymorphismTrampoline( PolymorphismTrampoline { class: Py( 0x000055a33c03f340, ), serializer: PolymorphismTrampoline( PolymorphismTrampoline { class: Py( 0x000055a33c03f340, ), serializer: Dataclass( DataclassSerializer { class: Py( 0x000055a33c03f340, ), serializer: Fields( GeneralFieldsSerializer { fields: { "temperature": SerField { key: "temperature", alias: None, serializer: Some( WithDefault( WithDefaultSerializer { default: Default( Py( 0x00007fbde4f1ab30, ), ), serializer: Float( FloatSerializer { inf_nan_mode: Null, }, ), }, ), ), required: true, serialize_by_alias: None, serialization_exclude_if: None, }, "tolerance": SerField { key: "tolerance", alias: None, serializer: Some( WithDefault( WithDefaultSerializer { default: Default( Py( 0x00007fbde4f1b530, ), ), serializer: Union( UnionSerializer { choices: UnionChoices { choices: [ Float( FloatSerializer { inf_nan_mode: Null, }, ), Dict( DictSerializer { key_serializer: Str( StrSerializer, ), value_serializer: Float( FloatSerializer { inf_nan_mode: Null, }, ), filter: SchemaFilter { include: None, exclude: None, }, name: "dict[str, float]", }, ), ], }, name: "Union[float, dict[str, float]]", }, ), }, ), ), required: true, serialize_by_alias: None, serialization_exclude_if: None, }, "sampling_wrapper": SerField { key: "sampling_wrapper", alias: None, serializer: Some( WithDefault( WithDefaultSerializer { default: DefaultFactory( Py( 0x000055a327ccfec0, ), false, ), serializer: Dict( DictSerializer { key_serializer: Any( AnySerializer, ), value_serializer: Any( AnySerializer, ), filter: SchemaFilter { include: None, exclude: None, }, name: "dict[any, any]", }, ), }, ), ), required: true, serialize_by_alias: None, serialization_exclude_if: None, }, "algorithm_version": SerField { key: "algorithm_version", alias: None, serializer: Some( WithDefault( WithDefaultSerializer { default: Default( Py( 0x00007fbde982f470, ), ), serializer: Str( StrSerializer, ), }, ), ), required: true, serialize_by_alias: None, serialization_exclude_if: None, }, "batch_size": SerField { key: "batch_size", alias: None, serializer: Some( WithDefault( WithDefaultSerializer { default: Default( Py( 0x00007fbecab004d0, ), ), serializer: Int( IntSerializer, ), }, ), ), required: true, serialize_by_alias: None, serialization_exclude_if: None, }, "search": SerField { key: "search", alias: None, serializer: Some( WithDefault( WithDefaultSerializer { default: Default( Py( 0x00007fbec9fd4f70, ), ), serializer: Str( StrSerializer, ), }, ), ), required: true, serialize_by_alias: None, serialization_exclude_if: None, }, }, computed_fields: Some( ComputedFields( [], ), ), mode: SimpleDict, extra_serializer: None, filter: SchemaFilter { include: None, exclude: None, }, required_fields: 6, }, ), fields: [ Py( 0x00007fbec643dde0, ), Py( 0x00007fbecab9ecb0, ), Py( 0x00007fbe51111c30, ), Py( 0x00007fbec64387b0, ), Py( 0x00007fbec6410cf0, ), Py( 0x00007fbde4b4ef60, ), ], name: "RegressionTransformerProteins", }, ), enabled_from_config: false, }, ), enabled_from_config: false, }, ), definitions=[])¶
- __pydantic_validator__ = SchemaValidator(title="RegressionTransformerProteins", validator=Dataclass( DataclassValidator { strict: false, validator: DataclassArgs( DataclassArgsValidator { fields: [ Field { kw_only: false, name: "algorithm_version", init: true, init_only: false, lookup_path_collection: LookupPathCollection { by_name: LookupPath { first_item: PathItemString( "algorithm_version", ), rest: [], }, by_alias: [], }, validator: WithDefault( WithDefaultValidator { default: Default( Py( 0x00007fbde982f470, ), ), on_error: Raise, validator: Str( StrValidator { strict: false, coerce_numbers_to_str: false, }, ), validate_default: false, copy_default: false, name: "default[str]", undefined: Py( 0x00007fbec86c3ba0, ), }, ), frozen: false, }, Field { kw_only: false, name: "search", init: true, init_only: false, lookup_path_collection: LookupPathCollection { by_name: LookupPath { first_item: PathItemString( "search", ), rest: [], }, by_alias: [], }, validator: WithDefault( WithDefaultValidator { default: Default( Py( 0x00007fbec9fd4f70, ), ), on_error: Raise, validator: Str( StrValidator { strict: false, coerce_numbers_to_str: false, }, ), validate_default: false, copy_default: false, name: "default[str]", undefined: Py( 0x00007fbec86c3ba0, ), }, ), frozen: false, }, Field { kw_only: false, name: "temperature", init: true, init_only: false, lookup_path_collection: LookupPathCollection { by_name: LookupPath { first_item: PathItemString( "temperature", ), rest: [], }, by_alias: [], }, validator: WithDefault( WithDefaultValidator { default: Default( Py( 0x00007fbde4f1ab30, ), ), on_error: Raise, validator: Float( FloatValidator { strict: false, allow_inf_nan: true, }, ), validate_default: false, copy_default: false, name: "default[float]", undefined: Py( 0x00007fbec86c3ba0, ), }, ), frozen: false, }, Field { kw_only: false, name: "batch_size", init: true, init_only: false, lookup_path_collection: LookupPathCollection { by_name: LookupPath { first_item: PathItemString( "batch_size", ), rest: [], }, by_alias: [], }, validator: WithDefault( WithDefaultValidator { default: Default( Py( 0x00007fbecab004d0, ), ), on_error: Raise, validator: Int( IntValidator { strict: false, }, ), validate_default: false, copy_default: false, name: "default[int]", undefined: Py( 0x00007fbec86c3ba0, ), }, ), frozen: false, }, Field { kw_only: false, name: "tolerance", init: true, init_only: false, lookup_path_collection: LookupPathCollection { by_name: LookupPath { first_item: PathItemString( "tolerance", ), rest: [], }, by_alias: [], }, validator: WithDefault( WithDefaultValidator { default: Default( Py( 0x00007fbde4f1b530, ), ), on_error: Raise, validator: Union( UnionValidator { mode: Smart, choices: [ ( Float( FloatValidator { strict: false, allow_inf_nan: true, }, ), None, ), ( Dict( DictValidator { strict: false, key_validator: Str( StrValidator { strict: false, coerce_numbers_to_str: false, }, ), value_validator: Float( FloatValidator { strict: false, allow_inf_nan: true, }, ), min_length: None, max_length: None, fail_fast: false, name: "dict[str,float]", }, ), None, ), ], custom_error: None, name: "union[float,dict[str,float]]", }, ), validate_default: false, copy_default: false, name: "default[union[float,dict[str,float]]]", undefined: Py( 0x00007fbec86c3ba0, ), }, ), frozen: false, }, Field { kw_only: false, name: "sampling_wrapper", init: true, init_only: false, lookup_path_collection: LookupPathCollection { by_name: LookupPath { first_item: PathItemString( "sampling_wrapper", ), rest: [], }, by_alias: [], }, validator: WithDefault( WithDefaultValidator { default: DefaultFactory( Py( 0x000055a327ccfec0, ), false, ), on_error: Raise, validator: Dict( DictValidator { strict: false, key_validator: Any( AnyValidator, ), value_validator: Any( AnyValidator, ), min_length: None, max_length: None, fail_fast: false, name: "dict[any,any]", }, ), validate_default: false, copy_default: false, name: "default[dict[any,any]]", undefined: Py( 0x00007fbec86c3ba0, ), }, ), frozen: false, }, ], positional_count: 6, init_only_count: None, dataclass_name: "RegressionTransformerProteins", validator_name: "dataclass-args[RegressionTransformerProteins]", extra_behavior: Ignore, extras_validator: None, loc_by_alias: true, validate_by_alias: None, validate_by_name: None, }, ), class: Py( 0x000055a33c03f340, ), generic_origin: None, fields: [ Py( 0x00007fbec643dde0, ), Py( 0x00007fbecab9ecb0, ), Py( 0x00007fbe51111c30, ), Py( 0x00007fbec64387b0, ), Py( 0x00007fbec6410cf0, ), Py( 0x00007fbde4b4ef60, ), ], post_init: None, revalidate: Never, name: "RegressionTransformerProteins", frozen: false, slots: true, }, ), definitions=[], cache_strings=True)¶
- __repr__()¶
Return repr(self).
- __signature__ = <Signature (algorithm_version: str = 'stability', search: str = 'sample', temperature: float = 1.4, batch_size: int = 32, tolerance: Union[float, Dict[str, float]] = 20.0, sampling_wrapper: Dict = <factory>) -> None>¶
- __wrapped__¶
alias of
RegressionTransformerProteins