gt4sd.algorithms.conditional_generation.paccmann_rl.core module¶
PaccMannRL Algorithm.
PaccMannRL generation is conditioned via reinforcement learning.
Summary¶
Classes:
PaccMannRL Algorithm.  | 
|
Configuration to generate compounds with low IC50 for a target omics profile.  | 
|
Configuration to generate compounds with high affinity to a target protein.  | 
Reference¶
- class PaccMannRL(configuration, target)[source]¶
 Bases:
GeneratorAlgorithm[S,T]PaccMannRL Algorithm.
- __init__(configuration, target)[source]¶
 Instantiate PaccMannRL ready to generate items.
- Parameters
 configuration (
AlgorithmConfiguration[~S, ~T]) – domain and application specification defining parameters, types and validations.target (
Optional[~T,None]) – a target for which to generate items.
Example
An example for generating small molecules (SMILES) with high affinity for a target protein:
affinity_config = PaccMannRLProteinBasedGenerator() target = "MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTT" paccmann_affinity = PaccMannRL(configuration=affinity_config, target=target) items = list(paccmann_affinity.sample(10)) print(items)
- get_generator(configuration, target)[source]¶
 Get the function to sample batches via PaccMannRL’s ConditionalGenerator.
- Parameters
 configuration (
AlgorithmConfiguration[~S, ~T]) – helps to set up specific application of PaccMannRL.target (
Optional[~T,None]) – context or condition for the generation.
- Return type
 Callable[[~T],Iterable[Any]]- Returns
 callable with target generating a batch of items.
- validate_configuration(configuration)[source]¶
 Overload to validate the a configuration for the algorithm.
- Parameters
 configuration (
AlgorithmConfiguration[~S, ~T]) – the algorithm configuration.- Raises
 InvalidAlgorithmConfiguration – in case the configuration for the algorithm is invalid.
- Return type
 AlgorithmConfiguration[~S, ~T]- Returns
 the validated configuration.
- __abstractmethods__ = frozenset({})¶
 
- __annotations__ = {'generate': 'Untargeted', 'generator': 'Union[Untargeted, Targeted[T]]', 'max_runtime': 'int', 'max_samples': 'int', 'target': 'Optional[T]'}¶
 
- __doc__ = 'PaccMann\\ :superscript:`RL` Algorithm.'¶
 
- __module__ = 'gt4sd.algorithms.conditional_generation.paccmann_rl.core'¶
 
- __orig_bases__ = (gt4sd.algorithms.core.GeneratorAlgorithm[~S, ~T],)¶
 
- __parameters__ = (~S, ~T)¶
 
- _abc_impl = <_abc._abc_data object>¶
 
- class PaccMannRLProteinBasedGenerator(*args, **kwargs)[source]¶
 Bases:
PaccMannRLProteinBasedGenerator,Generic[T]Configuration to generate compounds with high affinity to a target protein.
Implementation from the paper: https://doi.org/10.1088/2632-2153/abe808.
- algorithm_type: ClassVar[str] = 'conditional_generation'¶
 General type of generative algorithm.
- domain: ClassVar[str] = 'materials'¶
 General application domain. Hints at input/output types.
- algorithm_version: str = 'v0'¶
 To differentiate between different versions of an application.
There is no imposed naming convention.
- batch_size: int = 32¶
 
- temperature: float = 1.4¶
 
- generated_length: int = 100¶
 
- get_target_description()[source]¶
 Get description of the target for generation.
- Return type
 Dict[str,str]- Returns
 target description.
- get_conditional_generator(resources_path)[source]¶
 Instantiate the actual generator implementation.
- Parameters
 resources_path (
str) – local path to model files.- Return type
 - Returns
 instance with
generate_batchmethod for targeted generation.
- validate_item(item)[source]¶
 Check that item is a valid SMILES.
- Parameters
 item (
str) – a generated item that is possibly not valid.- Raises
 InvalidItem – in case the item can not be validated.
- Return type
 str- Returns
 the validated SMILES.
- __annotations__ = {'algorithm_application': 'ClassVar[str]', 'algorithm_name': 'ClassVar[str]', 'algorithm_type': typing.ClassVar[str], 'algorithm_version': <class 'str'>, 'batch_size': <class 'int'>, 'domain': typing.ClassVar[str], 'generated_length': <class 'int'>, 'temperature': <class 'float'>}¶
 
- __dataclass_fields__ = {'algorithm_application': Field(name='algorithm_application',type=typing.ClassVar[str],default='PaccMannRLProteinBasedGenerator',default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({}),kw_only=<dataclasses._MISSING_TYPE object>,_field_type=_FIELD_CLASSVAR), 'algorithm_name': Field(name='algorithm_name',type=typing.ClassVar[str],default='PaccMannRL',default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({}),kw_only=<dataclasses._MISSING_TYPE object>,_field_type=_FIELD_CLASSVAR), 'algorithm_type': Field(name='algorithm_type',type=typing.ClassVar[str],default='conditional_generation',default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({}),kw_only=<dataclasses._MISSING_TYPE object>,_field_type=_FIELD_CLASSVAR), 'algorithm_version': Field(name='algorithm_version',type=<class 'str'>,default='v0',default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({}),kw_only=False,_field_type=_FIELD), 'batch_size': Field(name='batch_size',type=<class 'int'>,default=32,default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({'description': 'Batch size used for the generative model sampling.'}),kw_only=False,_field_type=_FIELD), 'domain': Field(name='domain',type=typing.ClassVar[str],default='materials',default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({}),kw_only=<dataclasses._MISSING_TYPE object>,_field_type=_FIELD_CLASSVAR), 'generated_length': Field(name='generated_length',type=<class 'int'>,default=100,default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({'description': 'Maximum length in tokens of the generated molcules (relates to the SMILES length).'}),kw_only=False,_field_type=_FIELD), 'temperature': Field(name='temperature',type=<class 'float'>,default=1.4,default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({'description': 'Temperature parameter for the softmax sampling in decoding.'}),kw_only=False,_field_type=_FIELD)}¶
 
- __dataclass_params__ = _DataclassParams(init=True,repr=True,eq=True,order=False,unsafe_hash=False,frozen=False)¶
 
- __doc__ = '\n Configuration to generate compounds with high affinity to a target protein.\n\n Implementation from the paper: https://doi.org/10.1088/2632-2153/abe808.\n '¶
 
- __eq__(other)¶
 Return self==value.
- __hash__ = None¶
 
- __init__(*args, **kwargs)¶
 
- __is_pydantic_dataclass__ = True¶
 
- __match_args__ = ('algorithm_version', 'batch_size', 'temperature', 'generated_length')¶
 
- __module__ = 'gt4sd.algorithms.conditional_generation.paccmann_rl.core'¶
 
- __orig_bases__ = (<class 'types.PaccMannRLProteinBasedGenerator'>, typing.Generic[~T])¶
 
- __parameters__ = (~T,)¶
 
- __pydantic_complete__ = True¶
 
- __pydantic_config__ = {}¶
 
- __pydantic_core_schema__ = {'cls': <class 'gt4sd.algorithms.conditional_generation.paccmann_rl.core.PaccMannRLProteinBasedGenerator'>, 'config': {'title': 'PaccMannRLProteinBasedGenerator'}, 'fields': ['algorithm_version', 'batch_size', 'temperature', 'generated_length'], 'frozen': False, 'post_init': False, 'ref': 'types.PaccMannRLProteinBasedGenerator:93913119854176', 'schema': {'collect_init_only': False, 'computed_fields': [], 'dataclass_name': 'PaccMannRLProteinBasedGenerator', 'fields': [{'type': 'dataclass-field', 'name': 'algorithm_version', 'schema': {'type': 'default', 'schema': {'type': 'str'}, 'default': 'v0'}, 'kw_only': False, 'init': True, 'metadata': {}}, {'type': 'dataclass-field', 'name': 'batch_size', 'schema': {'type': 'default', 'schema': {'type': 'int'}, 'default': 32}, 'kw_only': False, 'init': True, 'metadata': {'pydantic_js_updates': {'description': 'Batch size used for the generative model sampling.'}}}, {'type': 'dataclass-field', 'name': 'temperature', 'schema': {'type': 'default', 'schema': {'type': 'float'}, 'default': 1.4}, 'kw_only': False, 'init': True, 'metadata': {'pydantic_js_updates': {'description': 'Temperature parameter for the softmax sampling in decoding.'}}}, {'type': 'dataclass-field', 'name': 'generated_length', 'schema': {'type': 'default', 'schema': {'type': 'int'}, 'default': 100}, 'kw_only': False, 'init': True, 'metadata': {'pydantic_js_updates': {'description': 'Maximum length in tokens of the generated molcules (relates to the SMILES length).'}}}], 'type': 'dataclass-args'}, 'slots': True, 'type': 'dataclass'}¶
 
- __pydantic_decorators__ = DecoratorInfos(validators={}, field_validators={}, root_validators={}, field_serializers={}, model_serializers={}, model_validators={}, computed_fields={})¶
 
- __pydantic_fields__ = {'algorithm_version': FieldInfo(annotation=str, required=False, default='v0', init=True, init_var=False, kw_only=False), 'batch_size': FieldInfo(annotation=int, required=False, default=32, description='Batch size used for the generative model sampling.', init=True, init_var=False, kw_only=False), 'generated_length': FieldInfo(annotation=int, required=False, default=100, description='Maximum length in tokens of the generated molcules (relates to the SMILES length).', init=True, init_var=False, kw_only=False), 'temperature': FieldInfo(annotation=float, required=False, default=1.4, description='Temperature parameter for the softmax sampling in decoding.', init=True, init_var=False, kw_only=False)}¶
 
- classmethod __pydantic_fields_complete__()¶
 Return whether the fields where successfully collected (i.e. type hints were successfully resolves).
This is a private property, not meant to be used outside Pydantic.
- Return type
 bool
- __pydantic_serializer__ = SchemaSerializer(serializer=Dataclass( DataclassSerializer { class: Py( 0x00005569da260e60, ), serializer: Fields( GeneralFieldsSerializer { fields: { "temperature": SerField { key_py: Py( 0x00007f8560c6fcf0, ), alias: None, alias_py: None, serializer: Some( WithDefault( WithDefaultSerializer { default: Default( Py( 0x00007f8560fefcd0, ), ), serializer: Float( FloatSerializer { inf_nan_mode: Null, }, ), }, ), ), required: true, serialize_by_alias: None, }, "generated_length": SerField { key_py: Py( 0x00007f8560c7dde0, ), alias: None, alias_py: None, serializer: Some( WithDefault( WithDefaultSerializer { default: Default( Py( 0x00007f86404a0d50, ), ), serializer: Int( IntSerializer, ), }, ), ), required: true, serialize_by_alias: None, }, "batch_size": SerField { key_py: Py( 0x00007f8560c6fb70, ), alias: None, alias_py: None, serializer: Some( WithDefault( WithDefaultSerializer { default: Default( Py( 0x00007f86404a04d0, ), ), serializer: Int( IntSerializer, ), }, ), ), required: true, serialize_by_alias: None, }, "algorithm_version": SerField { key_py: Py( 0x00007f8560c7dd90, ), alias: None, alias_py: None, serializer: Some( WithDefault( WithDefaultSerializer { default: Default( Py( 0x00007f863c298a30, ), ), serializer: Str( StrSerializer, ), }, ), ), required: true, serialize_by_alias: None, }, }, computed_fields: Some( ComputedFields( [], ), ), mode: SimpleDict, extra_serializer: None, filter: SchemaFilter { include: None, exclude: None, }, required_fields: 4, }, ), fields: [ Py( 0x00007f863c2ac030, ), Py( 0x00007f863c299270, ), Py( 0x00007f861311b9b0, ), Py( 0x00007f8560be5160, ), ], name: "PaccMannRLProteinBasedGenerator", }, ), definitions=[])¶
 
- __pydantic_validator__ = SchemaValidator(title="PaccMannRLProteinBasedGenerator", validator=Dataclass( DataclassValidator { strict: false, validator: DataclassArgs( DataclassArgsValidator { fields: [ Field { kw_only: false, name: "algorithm_version", py_name: Py( 0x00007f863c2ac030, ), init: true, init_only: false, lookup_key_collection: LookupKeyCollection { by_name: Simple( LookupPath { first_item: PathItemString { key: "algorithm_version", py_key: Py( 0x00007f8560c7dcf0, ), }, rest: [], }, ), by_alias: None, by_alias_then_name: None, }, validator: WithDefault( WithDefaultValidator { default: Default( Py( 0x00007f863c298a30, ), ), on_error: Raise, validator: Str( StrValidator { strict: false, coerce_numbers_to_str: false, }, ), validate_default: false, copy_default: false, name: "default[str]", undefined: Py( 0x00007f863e1e3a60, ), }, ), frozen: false, }, Field { kw_only: false, name: "batch_size", py_name: Py( 0x00007f863c299270, ), init: true, init_only: false, lookup_key_collection: LookupKeyCollection { by_name: Simple( LookupPath { first_item: PathItemString { key: "batch_size", py_key: Py( 0x00007f8560c6f230, ), }, rest: [], }, ), by_alias: None, by_alias_then_name: None, }, validator: WithDefault( WithDefaultValidator { default: Default( Py( 0x00007f86404a04d0, ), ), on_error: Raise, validator: Int( IntValidator { strict: false, }, ), validate_default: false, copy_default: false, name: "default[int]", undefined: Py( 0x00007f863e1e3a60, ), }, ), frozen: false, }, Field { kw_only: false, name: "temperature", py_name: Py( 0x00007f861311b9b0, ), init: true, init_only: false, lookup_key_collection: LookupKeyCollection { by_name: Simple( LookupPath { first_item: PathItemString { key: "temperature", py_key: Py( 0x00007f8560c6f370, ), }, rest: [], }, ), by_alias: None, by_alias_then_name: None, }, validator: WithDefault( WithDefaultValidator { default: Default( Py( 0x00007f8560fefcd0, ), ), on_error: Raise, validator: Float( FloatValidator { strict: false, allow_inf_nan: true, }, ), validate_default: false, copy_default: false, name: "default[float]", undefined: Py( 0x00007f863e1e3a60, ), }, ), frozen: false, }, Field { kw_only: false, name: "generated_length", py_name: Py( 0x00007f8560be5160, ), init: true, init_only: false, lookup_key_collection: LookupKeyCollection { by_name: Simple( LookupPath { first_item: PathItemString { key: "generated_length", py_key: Py( 0x00007f8560c7dd40, ), }, rest: [], }, ), by_alias: None, by_alias_then_name: None, }, validator: WithDefault( WithDefaultValidator { default: Default( Py( 0x00007f86404a0d50, ), ), on_error: Raise, validator: Int( IntValidator { strict: false, }, ), validate_default: false, copy_default: false, name: "default[int]", undefined: Py( 0x00007f863e1e3a60, ), }, ), frozen: false, }, ], positional_count: 4, init_only_count: None, dataclass_name: "PaccMannRLProteinBasedGenerator", validator_name: "dataclass-args[PaccMannRLProteinBasedGenerator]", extra_behavior: Ignore, extras_validator: None, loc_by_alias: true, validate_by_alias: None, validate_by_name: None, }, ), class: Py( 0x00005569da260e60, ), generic_origin: None, fields: [ Py( 0x00007f863c2ac030, ), Py( 0x00007f863c299270, ), Py( 0x00007f861311b9b0, ), Py( 0x00007f8560be5160, ), ], post_init: None, revalidate: Never, name: "PaccMannRLProteinBasedGenerator", frozen: false, slots: true, }, ), definitions=[], cache_strings=True)¶
 
- __repr__()¶
 Return repr(self).
- __signature__ = <Signature (algorithm_version: str = 'v0', batch_size: int = 32, temperature: float = 1.4, generated_length: int = 100) -> None>¶
 
- __wrapped__¶
 alias of
PaccMannRLProteinBasedGenerator
- class PaccMannRLOmicBasedGenerator(*args, **kwargs)[source]¶
 Bases:
PaccMannRLOmicBasedGenerator,Generic[T]Configuration to generate compounds with low IC50 for a target omics profile.
Implementation from the paper: https://doi.org/10.1016/j.isci.2021.102269.
- algorithm_type: ClassVar[str] = 'conditional_generation'¶
 General type of generative algorithm.
- domain: ClassVar[str] = 'materials'¶
 General application domain. Hints at input/output types.
- algorithm_version: str = 'v0'¶
 To differentiate between different versions of an application.
There is no imposed naming convention.
- batch_size: int = 32¶
 
- temperature: float = 1.4¶
 
- generated_length: int = 100¶
 
- get_target_description()[source]¶
 Get description of the target for generation.
- Return type
 Dict[str,str]- Returns
 target description.
- get_conditional_generator(resources_path)[source]¶
 Instantiate the actual generator implementation.
- Parameters
 resources_path (
str) – local path to model files.- Return type
 - Returns
 instance with
generate_batchmethod for targeted generation.
- validate_item(item)[source]¶
 Check that item is a valid SMILES.
- Parameters
 item (
str) – a generated item that is possibly not valid.- Raises
 InvalidItem – in case the item can not be validated.
- Return type
 str- Returns
 the validated SMILES.
- __annotations__ = {'algorithm_application': 'ClassVar[str]', 'algorithm_name': 'ClassVar[str]', 'algorithm_type': typing.ClassVar[str], 'algorithm_version': <class 'str'>, 'batch_size': <class 'int'>, 'domain': typing.ClassVar[str], 'generated_length': <class 'int'>, 'temperature': <class 'float'>}¶
 
- __dataclass_fields__ = {'algorithm_application': Field(name='algorithm_application',type=typing.ClassVar[str],default='PaccMannRLOmicBasedGenerator',default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({}),kw_only=<dataclasses._MISSING_TYPE object>,_field_type=_FIELD_CLASSVAR), 'algorithm_name': Field(name='algorithm_name',type=typing.ClassVar[str],default='PaccMannRL',default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({}),kw_only=<dataclasses._MISSING_TYPE object>,_field_type=_FIELD_CLASSVAR), 'algorithm_type': Field(name='algorithm_type',type=typing.ClassVar[str],default='conditional_generation',default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({}),kw_only=<dataclasses._MISSING_TYPE object>,_field_type=_FIELD_CLASSVAR), 'algorithm_version': Field(name='algorithm_version',type=<class 'str'>,default='v0',default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({}),kw_only=False,_field_type=_FIELD), 'batch_size': Field(name='batch_size',type=<class 'int'>,default=32,default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({'description': 'Batch size used for the generative model sampling.'}),kw_only=False,_field_type=_FIELD), 'domain': Field(name='domain',type=typing.ClassVar[str],default='materials',default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({}),kw_only=<dataclasses._MISSING_TYPE object>,_field_type=_FIELD_CLASSVAR), 'generated_length': Field(name='generated_length',type=<class 'int'>,default=100,default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({'description': 'Maximum length in tokens of the generated molcules (relates to the SMILES length).'}),kw_only=False,_field_type=_FIELD), 'temperature': Field(name='temperature',type=<class 'float'>,default=1.4,default_factory=<dataclasses._MISSING_TYPE object>,init=True,repr=True,hash=None,compare=True,metadata=mappingproxy({'description': 'Temperature parameter for the softmax sampling in decoding.'}),kw_only=False,_field_type=_FIELD)}¶
 
- __dataclass_params__ = _DataclassParams(init=True,repr=True,eq=True,order=False,unsafe_hash=False,frozen=False)¶
 
- __doc__ = '\n Configuration to generate compounds with low IC50 for a target omics profile.\n\n Implementation from the paper: https://doi.org/10.1016/j.isci.2021.102269.\n '¶
 
- __eq__(other)¶
 Return self==value.
- __hash__ = None¶
 
- __init__(*args, **kwargs)¶
 
- __is_pydantic_dataclass__ = True¶
 
- __match_args__ = ('algorithm_version', 'batch_size', 'temperature', 'generated_length')¶
 
- __module__ = 'gt4sd.algorithms.conditional_generation.paccmann_rl.core'¶
 
- __orig_bases__ = (<class 'types.PaccMannRLOmicBasedGenerator'>, typing.Generic[~T])¶
 
- __parameters__ = (~T,)¶
 
- __pydantic_complete__ = True¶
 
- __pydantic_config__ = {}¶
 
- __pydantic_core_schema__ = {'cls': <class 'gt4sd.algorithms.conditional_generation.paccmann_rl.core.PaccMannRLOmicBasedGenerator'>, 'config': {'title': 'PaccMannRLOmicBasedGenerator'}, 'fields': ['algorithm_version', 'batch_size', 'temperature', 'generated_length'], 'frozen': False, 'post_init': False, 'ref': 'types.PaccMannRLOmicBasedGenerator:93913119885200', 'schema': {'collect_init_only': False, 'computed_fields': [], 'dataclass_name': 'PaccMannRLOmicBasedGenerator', 'fields': [{'type': 'dataclass-field', 'name': 'algorithm_version', 'schema': {'type': 'default', 'schema': {'type': 'str'}, 'default': 'v0'}, 'kw_only': False, 'init': True, 'metadata': {}}, {'type': 'dataclass-field', 'name': 'batch_size', 'schema': {'type': 'default', 'schema': {'type': 'int'}, 'default': 32}, 'kw_only': False, 'init': True, 'metadata': {'pydantic_js_updates': {'description': 'Batch size used for the generative model sampling.'}}}, {'type': 'dataclass-field', 'name': 'temperature', 'schema': {'type': 'default', 'schema': {'type': 'float'}, 'default': 1.4}, 'kw_only': False, 'init': True, 'metadata': {'pydantic_js_updates': {'description': 'Temperature parameter for the softmax sampling in decoding.'}}}, {'type': 'dataclass-field', 'name': 'generated_length', 'schema': {'type': 'default', 'schema': {'type': 'int'}, 'default': 100}, 'kw_only': False, 'init': True, 'metadata': {'pydantic_js_updates': {'description': 'Maximum length in tokens of the generated molcules (relates to the SMILES length).'}}}], 'type': 'dataclass-args'}, 'slots': True, 'type': 'dataclass'}¶
 
- __pydantic_decorators__ = DecoratorInfos(validators={}, field_validators={}, root_validators={}, field_serializers={}, model_serializers={}, model_validators={}, computed_fields={})¶
 
- __pydantic_fields__ = {'algorithm_version': FieldInfo(annotation=str, required=False, default='v0', init=True, init_var=False, kw_only=False), 'batch_size': FieldInfo(annotation=int, required=False, default=32, description='Batch size used for the generative model sampling.', init=True, init_var=False, kw_only=False), 'generated_length': FieldInfo(annotation=int, required=False, default=100, description='Maximum length in tokens of the generated molcules (relates to the SMILES length).', init=True, init_var=False, kw_only=False), 'temperature': FieldInfo(annotation=float, required=False, default=1.4, description='Temperature parameter for the softmax sampling in decoding.', init=True, init_var=False, kw_only=False)}¶
 
- classmethod __pydantic_fields_complete__()¶
 Return whether the fields where successfully collected (i.e. type hints were successfully resolves).
This is a private property, not meant to be used outside Pydantic.
- Return type
 bool
- __pydantic_serializer__ = SchemaSerializer(serializer=Dataclass( DataclassSerializer { class: Py( 0x00005569da268790, ), serializer: Fields( GeneralFieldsSerializer { fields: { "algorithm_version": SerField { key_py: Py( 0x00007f8560c90530, ), alias: None, alias_py: None, serializer: Some( WithDefault( WithDefaultSerializer { default: Default( Py( 0x00007f863c298a30, ), ), serializer: Str( StrSerializer, ), }, ), ), required: true, serialize_by_alias: None, }, "batch_size": SerField { key_py: Py( 0x00007f8560c89ef0, ), alias: None, alias_py: None, serializer: Some( WithDefault( WithDefaultSerializer { default: Default( Py( 0x00007f86404a04d0, ), ), serializer: Int( IntSerializer, ), }, ), ), required: true, serialize_by_alias: None, }, "temperature": SerField { key_py: Py( 0x00007f8560c8a070, ), alias: None, alias_py: None, serializer: Some( WithDefault( WithDefaultSerializer { default: Default( Py( 0x00007f8560fefcd0, ), ), serializer: Float( FloatSerializer { inf_nan_mode: Null, }, ), }, ), ), required: true, serialize_by_alias: None, }, "generated_length": SerField { key_py: Py( 0x00007f8560c90580, ), alias: None, alias_py: None, serializer: Some( WithDefault( WithDefaultSerializer { default: Default( Py( 0x00007f86404a0d50, ), ), serializer: Int( IntSerializer, ), }, ), ), required: true, serialize_by_alias: None, }, }, computed_fields: Some( ComputedFields( [], ), ), mode: SimpleDict, extra_serializer: None, filter: SchemaFilter { include: None, exclude: None, }, required_fields: 4, }, ), fields: [ Py( 0x00007f863c2ac030, ), Py( 0x00007f863c299270, ), Py( 0x00007f861311b9b0, ), Py( 0x00007f8560be5160, ), ], name: "PaccMannRLOmicBasedGenerator", }, ), definitions=[])¶
 
- __pydantic_validator__ = SchemaValidator(title="PaccMannRLOmicBasedGenerator", validator=Dataclass( DataclassValidator { strict: false, validator: DataclassArgs( DataclassArgsValidator { fields: [ Field { kw_only: false, name: "algorithm_version", py_name: Py( 0x00007f863c2ac030, ), init: true, init_only: false, lookup_key_collection: LookupKeyCollection { by_name: Simple( LookupPath { first_item: PathItemString { key: "algorithm_version", py_key: Py( 0x00007f8560c90490, ), }, rest: [], }, ), by_alias: None, by_alias_then_name: None, }, validator: WithDefault( WithDefaultValidator { default: Default( Py( 0x00007f863c298a30, ), ), on_error: Raise, validator: Str( StrValidator { strict: false, coerce_numbers_to_str: false, }, ), validate_default: false, copy_default: false, name: "default[str]", undefined: Py( 0x00007f863e1e3a60, ), }, ), frozen: false, }, Field { kw_only: false, name: "batch_size", py_name: Py( 0x00007f863c299270, ), init: true, init_only: false, lookup_key_collection: LookupKeyCollection { by_name: Simple( LookupPath { first_item: PathItemString { key: "batch_size", py_key: Py( 0x00007f8560e01e70, ), }, rest: [], }, ), by_alias: None, by_alias_then_name: None, }, validator: WithDefault( WithDefaultValidator { default: Default( Py( 0x00007f86404a04d0, ), ), on_error: Raise, validator: Int( IntValidator { strict: false, }, ), validate_default: false, copy_default: false, name: "default[int]", undefined: Py( 0x00007f863e1e3a60, ), }, ), frozen: false, }, Field { kw_only: false, name: "temperature", py_name: Py( 0x00007f861311b9b0, ), init: true, init_only: false, lookup_key_collection: LookupKeyCollection { by_name: Simple( LookupPath { first_item: PathItemString { key: "temperature", py_key: Py( 0x00007f8560c896b0, ), }, rest: [], }, ), by_alias: None, by_alias_then_name: None, }, validator: WithDefault( WithDefaultValidator { default: Default( Py( 0x00007f8560fefcd0, ), ), on_error: Raise, validator: Float( FloatValidator { strict: false, allow_inf_nan: true, }, ), validate_default: false, copy_default: false, name: "default[float]", undefined: Py( 0x00007f863e1e3a60, ), }, ), frozen: false, }, Field { kw_only: false, name: "generated_length", py_name: Py( 0x00007f8560be5160, ), init: true, init_only: false, lookup_key_collection: LookupKeyCollection { by_name: Simple( LookupPath { first_item: PathItemString { key: "generated_length", py_key: Py( 0x00007f8560c904e0, ), }, rest: [], }, ), by_alias: None, by_alias_then_name: None, }, validator: WithDefault( WithDefaultValidator { default: Default( Py( 0x00007f86404a0d50, ), ), on_error: Raise, validator: Int( IntValidator { strict: false, }, ), validate_default: false, copy_default: false, name: "default[int]", undefined: Py( 0x00007f863e1e3a60, ), }, ), frozen: false, }, ], positional_count: 4, init_only_count: None, dataclass_name: "PaccMannRLOmicBasedGenerator", validator_name: "dataclass-args[PaccMannRLOmicBasedGenerator]", extra_behavior: Ignore, extras_validator: None, loc_by_alias: true, validate_by_alias: None, validate_by_name: None, }, ), class: Py( 0x00005569da268790, ), generic_origin: None, fields: [ Py( 0x00007f863c2ac030, ), Py( 0x00007f863c299270, ), Py( 0x00007f861311b9b0, ), Py( 0x00007f8560be5160, ), ], post_init: None, revalidate: Never, name: "PaccMannRLOmicBasedGenerator", frozen: false, slots: true, }, ), definitions=[], cache_strings=True)¶
 
- __repr__()¶
 Return repr(self).
- __signature__ = <Signature (algorithm_version: str = 'v0', batch_size: int = 32, temperature: float = 1.4, generated_length: int = 100) -> None>¶
 
- __wrapped__¶
 alias of
PaccMannRLOmicBasedGenerator